Our practice provides a full range of dental treatments including preventative, aesthetic, and restorative dentistry. Treatment options include porcelain veneers, whitening, fillings, bonding, cleanings, crowns and bridges, partial and full dentures, implants and extractions. For healthy teeth and a great smile call us today!

3.33 Rating by CuteStat

parkridgefamilydentalservices.com is 7 years 11 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, parkridgefamilydentalservices.com is SAFE to browse.

PageSpeed Score
100
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

74.52.155.70

Hosted Country:

United States of America US

Location Latitude:

32.7831

Location Longitude:

-96.8067

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 10
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 74.52.155.70)

Index of /

- viruviruppu.com
Not Applicable $ 8.95

YouTube

- vanderbilly.com

Check forget to check out: https://www.youtube.com/virtualzeppelin

Not Applicable $ 8.95

Minecraft Skins | Download the best Minecraft Skins

- minecraftskins.info

A selection of high quality minecraft skins available for free download. Create your own skins with our online editor.

Not Applicable $ 8.95

Rodeheavers Hot Rod

- unitedgearheads.com

mustang dyno tuning, pittsburgh dyno shop

Not Applicable $ 8.95

Luxury Bath Fixtures Shop

- luxurybathfixturesshop.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 10 Sep 2017 16:11:06 GMT
Server: Apache/2.4.25 (Unix) OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4 mod_fcgid/2.3.9 Resin/3.1.13
Last-Modified: Tue, 21 Mar 2017 18:36:43 GMT
ETag: "47d2-54b41ece5e4c0"
Accept-Ranges: bytes
Content-Length: 18386
Content-Type: text/html

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: May 19, 2016, 12:00 AM 7 years 11 months 22 hours ago
Last Modified: May 20, 2017, 12:00 AM 6 years 10 months 4 weeks ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns21.domaincontrol.com 97.74.100.11 United States of America United States of America
ns22.domaincontrol.com 173.201.68.11 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
parkridgefamilydentalservices.com A 596 IP: 50.63.202.2
parkridgefamilydentalservices.com NS 3599 Target: ns22.domaincontrol.com
parkridgefamilydentalservices.com NS 3599 Target: ns21.domaincontrol.com
parkridgefamilydentalservices.com SOA 599 MNAME: ns21.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2016051901
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600
parkridgefamilydentalservices.com MX 3599 Priority: 10
Target: mailstore1.secureserver.net
parkridgefamilydentalservices.com MX 3599 Target: smtp.secureserver.net

Full WHOIS Lookup

Domain Name: PARKRIDGEFAMILYDENTALSERVICES.COM
Registry Domain ID: 2029402753_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-05-20T17:35:40Z
Creation Date: 2016-05-19T16:42:39Z
Registry Expiry Date: 2018-05-19T16:42:39Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS21.DOMAINCONTROL.COM
Name Server: NS22.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-10T16:11:00Z