Web Analysis for Parkridgefamilydentalservices - parkridgefamilydentalservices.com
Our practice provides a full range of dental treatments including preventative, aesthetic, and restorative dentistry. Treatment options include porcelain veneers, whitening, fillings, bonding, cleanings, crowns and bridges, partial and full dentures, implants and extractions. For healthy teeth and a great smile call us today!
parkridgefamilydentalservices.com is 7 years 11 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, parkridgefamilydentalservices.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 10 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 74.52.155.70)
YouTube
Check forget to check out: https://www.youtube.com/virtualzeppelin
Minecraft Skins | Download the best Minecraft Skins
A selection of high quality minecraft skins available for free download. Create your own skins with our online editor.
Rodeheavers Hot Rod
mustang dyno tuning, pittsburgh dyno shop
HTTP Header Analysis
Date: Sun, 10 Sep 2017 16:11:06 GMT
Server: Apache/2.4.25 (Unix) OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4 mod_fcgid/2.3.9 Resin/3.1.13
Last-Modified: Tue, 21 Mar 2017 18:36:43 GMT
ETag: "47d2-54b41ece5e4c0"
Accept-Ranges: bytes
Content-Length: 18386
Content-Type: text/html
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns21.domaincontrol.com | 97.74.100.11 | United States of America | |
ns22.domaincontrol.com | 173.201.68.11 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
parkridgefamilydentalservices.com | A | 596 |
IP: 50.63.202.2 |
parkridgefamilydentalservices.com | NS | 3599 |
Target: ns22.domaincontrol.com |
parkridgefamilydentalservices.com | NS | 3599 |
Target: ns21.domaincontrol.com |
parkridgefamilydentalservices.com | SOA | 599 |
MNAME: ns21.domaincontrol.com RNAME: dns.jomax.net Serial: 2016051901 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 600 |
parkridgefamilydentalservices.com | MX | 3599 |
Priority: 10 Target: mailstore1.secureserver.net |
parkridgefamilydentalservices.com | MX | 3599 |
Target: smtp.secureserver.net |
Full WHOIS Lookup
Registry Domain ID: 2029402753_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-05-20T17:35:40Z
Creation Date: 2016-05-19T16:42:39Z
Registry Expiry Date: 2018-05-19T16:42:39Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS21.DOMAINCONTROL.COM
Name Server: NS22.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-10T16:11:00Z